BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5583 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  2761 rat defensin murine cryptidin VCYCRSRGCKGRERMNGTCRKGHLLYTLCCR 3624.3219 3621.7025 0.00 EC50
Peptide Data  2762 rabbit NP-5 defesin VFCTCRGFLCGSGERASGSCTINGVRHTLCCRR 3551.1149 3548.6200 0.00 EC50
Peptide Data  2763 rabbit NP-4 defensin VSCTCRRFSCGFGERASGSCTVNGVRHTLCCRR 3610.1423 3607.6320 0.00 EC50
Peptide Data  2764 rabbit NP-3B defensin GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR 4075.9036 4073.0617 0.00 EC50
Peptide Data  2765 rabbit defensin NP-3A GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR 4003.6299 4000.8705 0.00 EC50
Peptide Data  2766 rabbit defensin NP-2 VVCACRRALCLPLERRAAGFCRIRGRIHPLCCRR 3925.8186 3923.0778 0.00 EC50
Peptide Data  2767 rabbit defensin NP-1 VVCACRRALCLPRERRAGFCRIRGRIHPLCCRR 3897.7689 3895.0579 0.00 EC50
Peptide Data  2768 Heparin binding peptide KNNQKSEPLIGRKKT 1740.9962 1739.9976 0.00 EC50
Peptide Data  2769 YRVRVTPKEKTGPMKEM 2050.4445 2049.0829 0.00 EC50
Peptide Data  2770 Heparin binding peptide WQPPRARI 1023.1887 1022.5758 0.00 EC50
Peptide Data  2771 Heparin binding peptide YEKPGSPPREVVPRPRPGV 2117.4039 2116.1507 0.00 EC50
Peptide Data  2772 protease HIV1 inhibitor LLEYSI 736.8505 736.3993 0.00 EC50
Peptide Data  2773 Antiviral peptide LEYSI 623.6933 623.3155 0.00 EC50
Peptide Data  2774 Antiviral peptide LEYS 510.5361 510.2317 0.00 EC50
Peptide Data  2775 Antiviral peptide LLEY 536.6162 536.2836 0.00 EC50
First Previous Page: Next Last
Page 13 / 373
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)