BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5582 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  8168 peptide derived from κappa-casein (109-111) PPK 340.4168 340.2104 0.00 EC50
Peptide Data  8169 ACE inhibitor GPVRGPFPII 1052.2661 1051.6160 0.00 IC50
Peptide Data  8170 peptide derived from bovine aS2-casein (1-32) KNTMEHVSSSEESIISQETYKQEKNMAINPSK 3669.0061 3666.7446 0.00 EC50
Peptide Data  8171 Isracidin - peptide derived from alphaS1-casein (1-23) RPKHPIKHQGLPQEVLNENLLRF 2764.1833 2762.5411 0.00 EC50
Peptide Data  8172 peptide derived from bovine alphaS1-casein (194-199) TTMPLW 747.9008 747.3613 0.00 EC50
Peptide Data  8173 peptide derived from bovine b-casein (1-28) RELEELNVPGEIVESLSSSEESITRINK 3158.4179 3156.6096 0.00 EC50
Peptide Data  8174 peptide derived from bovine b-casein (1-28) LLYQEPVLGPVRGPFPIIV 2107.5295 2106.2203 0.00 EC50
Peptide Data  8175 bovine lactoferricin B FKCRRWQWRMKKLGAPSITCVRRAF 3125.7832 3123.6738 0.00 EC50
Peptide Data  8176 peptide derived from ovine colostral whey VESYVPLFP 1050.2008 1049.5415 0.00 EC50
Peptide Data  8177 tuftsin (human Fc region of IgG) YKPR 562.6600 562.3218 0.00 EC50
Peptide Data  8178 peptide derived from ovine aS2-casein (203–208) PYVRYL 809.9490 809.4422 0.00 EC50
Peptide Data  8179 Peptide derived from ovine alpha S2-casein (165–170) LKKISQ 715.8792 715.4578 2.60 IC50
Peptide Data  8180 peptide derived from bovine kappa-casein (28-30) IQY 422.4742 422.2158 70.40 IC50
Peptide Data  8181 ACE inhibitor FSDKIAK 807.9315 807.4476 113.60 IC50
Peptide Data  8182 ACE Inhibitor ALEP 428.4787 428.2263 6320.00 IC50
First Previous Page: Next Last
Page 163 / 373
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)