BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5587 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  8333 f(21-29) of alpha S1 casein IKHQGLPQE 1049.1780 1048.5648 0.00 EC50
Peptide Data  8334 f(30-37) of alpha S1 casein VLNENLLR 970.1212 969.5590 0.00 EC50
Peptide Data  8335 f(195-208) of alpha S1 casein SDIPNPIGSENSEK 1486.5331 1485.6923 0.00 EC50
Peptide Data  8336 fragment 165-181of ovine as2-casein LKKISQRYQKFALPQYL 2124.5203 2123.2218 0.00 EC50
Peptide Data  8337 Anticancer peptide FVAPFPEVFG 1109.2695 1108.5575 0.00 EC50
Peptide Data  8338 Mucin secretion stimulator YLGYLE 756.8403 756.3681 0.00 EC50
Peptide Data  8339 Alpha-Cazozepine YLGYLEQLLR 1267.4688 1266.6950 0.00 EC50
Peptide Data  8340 Anticancer peptide INKKI 614.7756 614.4103 0.00 EC50
Peptide Data  8341 Kappacin fragment AVESTVATLEDSPEVIESPPE 2199.3160 2198.0440 0.00 EC50
Peptide Data  8342 fragment 43-48 of bovine lactoferrin LECIRA 703.8500 703.3675 0.00 EC50
Peptide Data  8343 fragment 1-42 of bovine lactoferrin APRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFA 5150.0870 5146.6918 0.00 EC50
Peptide Data  8344 Casoparan INKKI 614.7756 614.4103 0.00 EC50
Peptide Data  8345 fragment 17-48 of bovine lactoferrin FKCRRWQWRMKKLGAPSITCVRRAFALECIRA 3882.6957 3880.0678 0.00 EC50
Peptide Data  8347 dipeptidyl peptidase IV inhibitor (DPP-IV inhibitor) VPL 327.4180 327.2151 15.80 IC50
Peptide Data  8348 ACE inhibitor SFHPYFSY 1047.1161 1046.4483 82.71 IC50
First Previous Page: Next Last
Page 174 / 373
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)