BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5583 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  2880 Beta-neoendorphin YGGFLRKYP 1100.2660 1099.5797 0.00 EC50
Peptide Data  2881 Opioid peptide alpha-neoendorphin YGGFLRKYPK 1228.4378 1227.6744 0.00 EC50
Peptide Data  2882 Immunostimulating peptide YG 238.2393 238.0950 0.00 EC50
Peptide Data  2885 h-nocistatin MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ 3561.9224 3559.6326 0.00 EC50
Peptide Data  2886 Opioid peptide YIPP 488.5751 488.2626 0.00 EC50
Peptide Data  2887 b-nocistatin TEPGLEEVGEIEQKQLQ 1927.0654 1925.9549 0.00 EC50
Peptide Data  2888 Neuropeptide EQKQLQ 772.8446 772.4066 0.00 EC50
Peptide Data  2889 Neuropeptide citropin 1.1 GLFDVIKKVASVIGGL~ 1614.9640 1613.9838 0.00 EC50
Peptide Data  2890 neuropeptide GQ 203.1953 203.0903 0.00 EC50
Peptide Data  2892 neuropeptide from eyestalk of Macrobrachium rosenbergii GYNRSFLRF~ 1158.3086 1157.6077 0.00 EC50
Peptide Data  2893 Neuropeptide FMRF~ 598.7594 598.3041 0.00 EC50
Peptide Data  2894 Neuropeptide NRNFLRF~ 965.1098 964.5341 0.00 EC50
Peptide Data  2895 Neuropeptide DRNFLRF~ 966.0946 965.5181 0.00 EC50
Peptide Data  2896 Neuropeptide KNEFIRF~ 952.1077 951.5275 0.00 EC50
Peptide Data  2897 Neuropeptide TNRNFLRF~ 1066.2134 1065.5816 0.00 EC50
First Previous Page: Next Last
Page 20 / 373
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)