BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5583 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  9534 Kyotorphin YR 337.3733 337.1745 0.00 EC50
Peptide Data  9535 Anti-dementia β-secretase Inhibitory Peptide from Arctoscopus japonicus GNTGPG 501.4897 501.2176 0.00 EC50
Peptide Data  9536 Precursor of human amylin KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG 3963.3201 3960.8786 0.00 EC50
Peptide Data  9537 Anti-inflammatory peptide IPP 325.4022 325.1995 0.00 EC50
Peptide Data  9538 Anti-inflammatory peptide VPP 311.3757 311.1839 0.00 EC50
Peptide Data  9539 ACE inhibitor EKVNELSK 946.0536 945.5114 5998.00 IC50
Peptide Data  9540 dipeptidyl peptidase IV inhibitor (DPP IV inhibitor) LPIIDI 682.8461 682.4251 105.44 IC50
Peptide Data  9541 dipeptidyl peptidase IV inhibitor (DPP IV inhibitor) APGPAGP 565.6177 565.2851 105.44 IC50
Peptide Data  9542 Anticancer peptide WTP 402.4432 402.1897 0.00 EC50
Peptide Data  9543 ACE inhibitor RYL 450.5305 450.2583 3.31 IC50
Peptide Data  9544 ACE inhibitor GIPLPLI 721.9250 721.4723 74.27 IC50
Peptide Data  9545 DPPIV inhibitor GIPLPLI 721.9250 721.4723 3.83 IC50
Peptide Data  9546 Sarconesin II VALTGLTVAEYFR 1439.6501 1438.7795 1.90 IC50
Peptide Data  9547 Alpha-glucosidase inhibitor YPL 391.4602 391.2100 3900.00 IC50
Peptide Data  9548 Alpha-glucosidase inhibitor YP 278.3030 278.1262 1680.00 IC50
First Previous Page: Next Last
Page 254 / 373
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)