BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5578 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  9849 Alpha-glucosidase inhibitor SWLRL 673.8014 673.3900 182.05 IC50
Peptide Data  9850 Alpha-glucosidase inhibitor WLRL 586.7243 586.3581 162.29 IC50
Peptide Data  9851 Peptide stimulating mucin secretion YPVEPF 750.8358 750.3576 0.00 EC50
Peptide Data  9852 Neocasomorphin YPVEPF 750.8358 750.3576 0.00 EC50
Peptide Data  9853 Peptide stimulating mucin secretion GVSKVKEAMAPKHKEMPFPKYPVEPFTESQ 3417.9414 3415.7252 0.00 EC50
Peptide Data  9854 Peptide stimulating mucin secretion GVSKVKEAMAPKHKE 1638.9256 1637.8895 0.00 EC50
Peptide Data  9855 Peptide stimulating mucin secretion EPFTESQ 836.8406 836.3539 0.00 EC50
Peptide Data  9856 Anti-inflammatory peptide PY 278.3030 278.1262 0.00 EC50
Peptide Data  9857 Anti-inflammatory peptide VYY 443.4917 443.2049 0.00 EC50
Peptide Data  9858 Anti-inflammatory peptide LGGW 431.4843 431.2162 0.00 EC50
Peptide Data  9859 Anti-inflammatory peptide GVYY 500.5429 500.2263 0.00 EC50
Peptide Data  9860 Anti-inflammatory peptide SACV 378.4445 378.1567 0.00 EC50
Peptide Data  9861 Anti-inflammatory peptide LLPF 488.6180 488.2989 0.00 EC50
Peptide Data  9862 Anti-inflammatory peptide APTLW 586.6781 586.3105 0.00 EC50
Peptide Data  9863 Anti-inflammatory peptide AAFAATY 713.7760 713.3373 0.00 EC50
First Previous Page: Next Last
Page 275 / 372
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)