BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5578 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  10119 SARS-CoV‑2 spike protein binding peptide LVMGLHVYLRQGK 1513.8452 1512.8573 0.00 EC50
Peptide Data  10120 Antioxidative peptide YPW 464.5125 464.2053 0.00 EC50
Peptide Data  10121 hemorphin-4 antioxidative YPWT 565.6161 565.2528 0.00 EC50
Peptide Data  10122 ACE inhibitor FRVW 606.7141 606.3269 18.34 IC50
Peptide Data  10123 ACE inhibitor LPYY 554.6331 554.2731 116.26 IC50
Peptide Data  10124 Soybean lunasin immunomodulating peptide SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD 5028.3057 5025.2238 0.00 EC50
Peptide Data  10125 Bile acid binding peptide VEEFYCS 875.9406 875.3358 0.00 EC50
Peptide Data  10126 Bile acid binding peptide VEEFYC 788.8635 788.3039 0.00 EC50
Peptide Data  10127 Bile acid binding peptide VYVFDE 770.8239 770.3474 0.00 EC50
Peptide Data  10128 Bile acid binding peptide IFIYDE 798.8769 798.3786 0.00 EC50
Peptide Data  10129 Bile acid binding peptide WEFIDF 855.9298 855.3790 0.00 EC50
Peptide Data  10130 Bile acid binding peptide ELYEFC 802.8900 802.3195 0.00 EC50
Peptide Data  10131 Rubiscolin-6 appetite regulating YPLDLF 766.8781 766.3888 0.00 EC50
Peptide Data  10132 ACE inhibitor LMP 359.4841 359.1872 15.80 IC50
Peptide Data  10133 Rapakinin – opioid antagonist RIY 450.5305 450.2583 0.00 EC50
First Previous Page: Next Last
Page 293 / 372
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)