Untitled Document

BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5362
	ID	Name	Sequence	Chem. mass	Monois. mass
Peptide Data	3051	inhibitor blood platelet aggregation	ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT	5425.1052	5421.3138	0.00 EC₅₀
Peptide Data	3053	Indolicidin	ILPWKWPWWPWRR~	1906.2792	1905.0439	0.00 EC₅₀
Peptide Data	3054	Thymopentin	RKDVY	679.7630	679.3642	0.00 EC₅₀
Peptide Data	3055	Bovine beta-casein fragment 1-25	RELEELNVPGEIVESLSSSEESITR	2802.9865	2801.3883	0.00 EC₅₀
Peptide Data	3056	Immunomodulating peptide	GKVLKKRR	984.2401	983.6698	0.00 EC₅₀
Peptide Data	3057	Immunomodulating peptide	YGKVLKKRR	1147.4130	1146.7329	0.00 EC₅₀
Peptide Data	3059	Immunostimulating peptide	YQQPVLGPVRGPFPIIV	1880.2303	1879.0687	0.00 EC₅₀
Peptide Data	3060	Immunomodulating peptide	SIKVAV	615.7604	615.3943	0.00 EC₅₀
Peptide Data	3061	Immunostimulating peptide	GFL	335.3971	335.1839	0.00 EC₅₀
Peptide Data	3062	DNA synthesis stimulating peptide	RETIESLSSSEESIPEYK	2084.1892	2082.9922	0.00 EC₅₀
Peptide Data	3063	DNA synthesis stimulating peptide	QPTIPFFDPQIPK	1527.7566	1526.8107	0.00 EC₅₀
Peptide Data	3064	Immunostimulating peptide	VEPIPY	716.8195	716.3732	0.00 EC₅₀
Peptide Data	3065	fragment of bovine beta-casein 191-193	LLY	407.5025	407.2412	0.00 EC₅₀
Peptide Data	3066	Immunostimulating peptide	EAE	347.3203	347.1323	0.00 EC₅₀
Peptide Data	3067	human endothelin III	CTCFTYKDKECVYYCHLDIIW	2647.0723	2645.1423	0.00 EC₅₀