BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5362 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  3083 DSDPR 588.5668 588.2495 0.00 EC50
Peptide Data  3086 guinea pig defensin GPNP RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC 3838.5584 3835.8345 0.00 EC50
Peptide Data  3087 Gluten exorphin C YPISL 591.6945 591.3257 13.50 EC50
Peptide Data  3088 gluten B5 exorphin YGGWL 594.6572 594.2793 0.02 EC50
Peptide Data  3089 gluten B4 exorphin YGGW 481.5000 481.1955 3.40 EC50
Peptide Data  3090 gluten A5 exorphin GYYPT 599.6307 599.2582 60.00 EC50
Peptide Data  3091 gluten A4 exorphin GYYP 498.5271 498.2107 70.00 EC50
Peptide Data  3092 oxyntomodulin KRNKNNIA 957.0861 956.5500 0.00 EC50
Peptide Data  3093 gliadin 2 exorphin YPLG 448.5114 448.2314 0.00 EC50
Peptide Data  3094 gliadin 1 exorphin PLG 285.3385 285.1683 0.00 EC50
Peptide Data  3095 Splenopentin RKEVY 693.7895 693.3798 0.00 EC50
Peptide Data  3096 fragment of laminin A chain: 2091-2108 CSRARKQAASIKVAVSADR 2017.3127 2016.0978 0.00 EC50
Peptide Data  3098 fragment of bovine beta casein (91-93) GVM 305.3939 305.1404 0.00 EC50
Peptide Data  3099 Immunostimulating peptide LGY 351.3965 351.1788 0.00 EC50
Peptide Data  3100 fragment of beta-amyloid protein: Q11-1-28 DAEFRHDSGYQVHHQKLVFFAEDVGSNK 3261.4649 3259.5387 0.00 EC50
First Previous Page: Next Last
Page 32 / 358
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)