BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5601 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  3101 beta-amyloid protein fragment:25-35 GSNKGAIIGLM 1060.2662 1059.5728 0.00 EC50
Peptide Data  3102 fragment of beta-amyloid protein:12-28 VHHQKLVFFAEDVGSNK 1955.1713 1954.0030 0.00 EC50
Peptide Data  3103 fragment of beta-amyloid protein: 1-28 DAEFRHDSGYEVHHQKLVFFAEDVGSNK 3262.4497 3260.5227 0.00 EC50
Peptide Data  3104 fragment of beta-amyloid protein: 1-16 DAEFRHDSGYQVHHQK 1954.0182 1952.8851 0.00 EC50
Peptide Data  3105 fragment of anafylatoxin C3a: 70-77 ASHLGLAR 823.9375 823.4651 0.00 EC50
Peptide Data  3106 adrenocorticotropic hormone Y fr: 4-9 YMEHFRW 1068.2058 1067.4633 0.00 EC50
Peptide Data  3107 adrenocorticotropin hormone fr. 7-38 FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE 3659.1045 3656.9157 0.00 EC50
Peptide Data  3108 adrenocorticotropin hormone fr.:4-11 MEHFRWGK 1090.2559 1089.5163 0.00 EC50
Peptide Data  3109 adrenocorticotropin hormone fr.: 4-10 MEHFRWG 962.0841 961.4216 0.00 EC50
Peptide Data  3110 adrenocorticotropin hormone fr.:11-24 KPVGKKRRPVKVYP 1652.0337 1651.0380 0.00 EC50
Peptide Data  3111 adrenocorticotropin hormone fr.: 1-4 SYSM 486.5391 486.1777 0.00 EC50
Peptide Data  3112 adrenocorticotropin hormone fr.: 1-24 SYSMEHFRWGKPVGKKRRPVKVYP 2933.4297 2931.5760 0.00 EC50
Peptide Data  3113 adrenocorticotropin hormone fr.: 1-17 SYSMEHFRWGKPVGKKR 2093.4086 2092.0757 0.00 EC50
Peptide Data  3114 adrenocorticotropin hormone fr.: 1-16 SYSMEHFRWGKPVGKK 1937.2234 1935.9748 0.00 EC50
Peptide Data  3115 adrenocorticotropin hormone fr.: 1-14 SYSMEHFRWGKPVG 1680.8798 1679.7854 0.00 EC50
First Previous Page: Next Last
Page 33 / 374
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)