BIOPEP-UWM: Bioactive peptides
| Number of peptides in database: 5583 | ||||||
| ID | Name | Sequence | Chem. mass | Monois. mass | ||
| Peptide Data | 3194 | Hemolytic peptide | FLPAIAGILSQLF~ | 1388.6909 | 1387.8202 | 0.00 EC50 |
| Peptide Data | 3195 | Precursor of hemolytic peptide | FLPLAIGLLGKLFG | 1458.8234 | 1457.8982 | 0.00 EC50 |
| Peptide Data | 3196 | Hemolytic peptide | FLPLILRKIVTAL~ | 1495.9310 | 1494.9984 | 0.00 EC50 |
| Peptide Data | 3197 | Precursor of hemolytic peptide | FLPLILRKIVTALG | 1553.9670 | 1553.0038 | 0.00 EC50 |
| Peptide Data | 3198 | Antiviral peptide | GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR | 4003.6299 | 4000.8705 | 0.00 EC50 |
| Peptide Data | 3199 | chymotrypsin inhibitor | PGVY | 434.4849 | 434.2158 | 0.00 EC50 |
| Peptide Data | 3200 | chymotrypsin inhibitor | PGAY | 406.4319 | 406.1846 | 0.00 EC50 |
| Peptide Data | 3201 | chymotrypsin inhibitor | GAW | 332.3536 | 332.1480 | 0.00 EC50 |
| Peptide Data | 3202 | Chymosin inhibitor (fr. 99-105 of bovine kappa-casein) | TPGVY | 535.5885 | 535.2633 | 0.00 EC50 |
| Peptide Data | 3203 | Chymosin inhibitor (fr. 99-105 of bovine kappa-casein) | PHPHLSF | 833.9308 | 833.4172 | 0.00 EC50 |
| Peptide Data | 3204 | Precursor of cecropin D from Cecropia (moth) | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAKG | 3850.3732 | 3848.0996 | 0.00 EC50 |
| Peptide Data | 3205 | Cecropin D from Cecropia (moth) | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK~ | 3792.3372 | 3790.0942 | 0.00 EC50 |
| Peptide Data | 3206 | Precursor of cecropin B from Cecropia (moth) | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG | 3892.6949 | 3890.2852 | 0.00 EC50 |
| Peptide Data | 3207 | cecropin B from Cecropia (moth) | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL~ | 3834.6589 | 3832.2798 | 0.00 EC50 |
| Peptide Data | 3208 | cecropin B analog (CB-3) | AIAVLGEAKALMGRNIRNGIVKAGPAIAVLGEAKALG | 3614.3011 | 3612.0961 | 0.00 EC50 |