BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5601 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  3194 Hemolytic peptide FLPAIAGILSQLF~ 1388.6909 1387.8202 0.00 EC50
Peptide Data  3195 Precursor of hemolytic peptide FLPLAIGLLGKLFG 1458.8234 1457.8982 0.00 EC50
Peptide Data  3196 Hemolytic peptide FLPLILRKIVTAL~ 1495.9310 1494.9984 0.00 EC50
Peptide Data  3197 Precursor of hemolytic peptide FLPLILRKIVTALG 1553.9670 1553.0038 0.00 EC50
Peptide Data  3198 Antiviral peptide GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR 4003.6299 4000.8705 0.00 EC50
Peptide Data  3199 chymotrypsin inhibitor PGVY 434.4849 434.2158 0.00 EC50
Peptide Data  3200 chymotrypsin inhibitor PGAY 406.4319 406.1846 0.00 EC50
Peptide Data  3201 chymotrypsin inhibitor GAW 332.3536 332.1480 0.00 EC50
Peptide Data  3202 Chymosin inhibitor (fr. 99-105 of bovine kappa-casein) TPGVY 535.5885 535.2633 0.00 EC50
Peptide Data  3203 Chymosin inhibitor (fr. 99-105 of bovine kappa-casein) PHPHLSF 833.9308 833.4172 0.00 EC50
Peptide Data  3204 Precursor of cecropin D from Cecropia (moth) WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAKG 3850.3732 3848.0996 0.00 EC50
Peptide Data  3205 Cecropin D from Cecropia (moth) WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK~ 3792.3372 3790.0942 0.00 EC50
Peptide Data  3206 Precursor of cecropin B from Cecropia (moth) KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG 3892.6949 3890.2852 0.00 EC50
Peptide Data  3207 cecropin B from Cecropia (moth) KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL~ 3834.6589 3832.2798 0.00 EC50
Peptide Data  3208 cecropin B analog (CB-3) AIAVLGEAKALMGRNIRNGIVKAGPAIAVLGEAKALG 3614.3011 3612.0961 0.00 EC50
First Previous Page: Next Last
Page 374 / 374
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)