Untitled Document

BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5362
	ID	Name	Sequence	Chem. mass	Monois. mass
Peptide Data	3194	Hemolytic peptide	FLPAIAGILSQLF~	1388.6909	1387.8202	0.00 EC₅₀
Peptide Data	3195	Precursor of hemolytic peptide	FLPLAIGLLGKLFG	1458.8234	1457.8982	0.00 EC₅₀
Peptide Data	3196	Hemolytic peptide	FLPLILRKIVTAL~	1495.9310	1494.9984	0.00 EC₅₀
Peptide Data	3197	Precursor of hemolytic peptide	FLPLILRKIVTALG	1553.9670	1553.0038	0.00 EC₅₀
Peptide Data	3198	Antiviral peptide	GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR	4003.6299	4000.8705	0.00 EC₅₀
Peptide Data	3199	chymotrypsin inhibitor	PGVY	434.4849	434.2158	0.00 EC₅₀
Peptide Data	3200	chymotrypsin inhibitor	PGAY	406.4319	406.1846	0.00 EC₅₀
Peptide Data	3201	chymotrypsin inhibitor	GAW	332.3536	332.1480	0.00 EC₅₀
Peptide Data	3202	Chymosin inhibitor (fr. 99-105 of bovine kappa-casein)	TPGVY	535.5885	535.2633	0.00 EC₅₀
Peptide Data	3203	Chymosin inhibitor (fr. 99-105 of bovine kappa-casein)	PHPHLSF	833.9308	833.4172	0.00 EC₅₀
Peptide Data	3204	Precursor of cecropin D from Cecropia (moth)	WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAKG	3850.3732	3848.0996	0.00 EC₅₀
Peptide Data	3205	Cecropin D from Cecropia (moth)	WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK~	3792.3372	3790.0942	0.00 EC₅₀
Peptide Data	3206	Precursor of cecropin B from Cecropia (moth)	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKALG	3892.6949	3890.2852	0.00 EC₅₀
Peptide Data	3207	cecropin B from Cecropia (moth)	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL~	3834.6589	3832.2798	0.00 EC₅₀
Peptide Data	3208	cecropin B analog (CB-3)	AIAVLGEAKALMGRNIRNGIVKAGPAIAVLGEAKALG	3614.3011	3612.0961	0.00 EC₅₀