BIOPEP-UWM: Protein Data
ID
Name
Sequence
KIFSKCELARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQAFNGRNSNGSSDYGIFQLNSKWWCKSNSHSSANACNIMCSKFLDDNIDDDIACSKRVVKDPNGMSAWVAWVKHCKGKDLSKYLASCNL
Chemical Mass
Number of residues
Monoisotopic Mass
Additional Information
Lysozyme type C and alpha-lactalbumin have similar primary sequence and structure. But they have different function. Lactalbumin promotes the conversion of galactosyltransferase to lactose synthase and is essential for milk production. Lysozyme catalyses the hydrolysis of bacterial cell wall polysaccharides; it has also been recruited for a digestive role in certain ruminants and colobine monkeys . Lactalbumins have the ability to bind calcium and such property is assigned to only a few lysozymes.
reference
function information
database references
screen and print protein data
list of proteins