BIOPEP-UWM: Protein Data
ID
Name
Sequence
KNTMEHV{S[3*]}{S[3*]}{S[3*]}EE{S[3*]}IISQETYKQEKNMAINP{S[3*]}KENL{C}STF{C}KEVVRNANEEE{S[3*]}AEVATEEVKITVDDKHYQKALNEINQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENSKKTVDME{S[3*]}TEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL
Chemical Mass
Number of residues
Monoisotopic Mass
Additional Information
Protein known as: allergen Bos d 8. Chain: from 16 to 222; signal peptide: from 1 to 15. Casein is one of the major milk proteins and plays important role in the capacity of milk to transport calcium phosphate. Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02663/entry). Sequence of mature protein (without signal peptide) is provided. Modified amino acid residues are annotated according to the UniProt database (Access. No P02663) {S[3*]} - phosphoserine: BIOPEP-UWM repository of amino acids and modifications; ID 108 {C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111 Sequence without modifications is annotated in the BIOPEP-UWM database of proteins (ID 1805)
reference
function information
database references
screen and print protein data
list of proteins