BIOPEP-UWM: Protein Data
ID
Name
Sequence
{P[4O]}EQNQEQPIR{C}EKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKS{C}QAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIA{S[3*]}GEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
Chemical Mass
Number of residues
Monoisotopic Mass
Additional Information
Protein known as: allergen Bos d 8. Chain: from 22 to 190; signal peptide: from 1 to 21. Casein is one of the major milk proteins produced in mammary gland. Casein plays important role in determination of surface properties of casein micelles. Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02668/entry). Sequence of mature protein (without signal peptide) is provided. Modified amino acid residues are annotated according to the UniProt database (Access. No P02668) {S[3*]} - phosphoserine: BIOPEP-UWM repository of amino acids and modifications; ID 108 {P[4O]} - L-pyroglutamic acid, BIOPEP-UWM repository of amino acids and modifications, ID 110 {C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111 Sequence without modifications is annotated in the BIOPEP-UWM database of proteins (ID 1117)
reference
function information
database references
screen and print protein data
list of proteins