BIOPEP-UWM: Report

ID 1092
Name lysozyme C precursor, chicken (Gallus gallus)
sequence
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL

Function:
Lysozyme type C and alpha-lactalbumin have similar primary sequence and structure. But they have different function. Lactalbumin promotes the conversion of galactosyltransferase to lactose synthase and is essential for milk production. Lysozyme catalyses the hydrolysis of bacterial cell wall polysaccharides; it has also been recruited for a digestive role in certain ruminants and colobine monkeys . Lactalbumins have the ability to bind calcium and such property is assigned to only a few lysozymes. Ref.: Swiss-Prot database (www.exapsy.org)
 
Number of residues 147
Chemical mass 16238.4645 Monoisotopic mass 16227.9930



Bibliographic data:
Authors
Jung A., Sippel A.E., Grez M., Schutz G.
Title
Exons encode functional and structural units of chicken lysozyme. Proc. Natl. Acad. Sci. U.S.A. 77:5759-5763.
Year Source
1980 Journal



Additional information:
Protein known as: 1,4-beta-N-acetylmuramidase C [EC 3.2.1.17], allergen Gal d 4, allergen Gal d IV.
Chain: from 19 to 147; signal peptide: from 1 to 18.
Ref.: Swiss-Prot database (www.expasy.org)



Database reference:
SWISS PROT entry name: LYC_CHICK, accession number: P00698