BIOPEP-UWM: Report

ID 1115
Name alpha-lactalbumin, gen. var. B, precursor, bovine (Bos taurus)
sequence
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

Function:
Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins. Ref.: Swiss-Prot database (www.expasy.org).
 
Number of residues 142
Chemical mass 16246.4126 Monoisotopic mass 16235.8826



Bibliographic data:
Authors
Vanaman T.C., Brew K., Hill R.L.
Title
The disulfide bonds of bovine alpha-lactalbumin. J. Biol. Chem. 245:4583-4590.
Year Source
1970 Journal



Additional information:
Protein known as: lactose synthase B protein, allergen Bos d 4. Chain: from 20 to 142; signal peptide: from 1 to 19.
Alpha-lactalbumin is synthesized only in the mammary gland. This protein is a regulatory subunit of lactose synthase and changes substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme.
Ref.: Swiss-Prot database (www.expasy.org).



Database reference:
Swiss-Prot database protein entry name/accesion number: LALBA_BOVIN/P00711. NCBI Taxonomic Identifier: 9913.