BIOPEP-UWM: Report
| ID |
1140 |
| Name |
legumin-like protein, mouse-ear cress (Arabidopsis thaliana) |
MELDLSPRLPKKVYGGDGGSYFAWCPEELPMLRDGNIGASKLALEKYGLALPRYSDSPKVAYVLQGAGTAGIVLPEKEEKVIAIKKGDSIALPFGVVTWWFNNEDTELVVLFLGETHKGHKAGQFTDFYLTGSNGIFTGFSTEFVGRAWDLDETTVKKLVGSQTGNGIVKVDASLKMPEPKKGDRKGFVLNCLEAPLDVDIKDGGRVVVLNTKNLPLVGEVGFGADLVRIDGHSMCSPGFSCDSALQVTYIVGGSGRVQIVGADGKRVLETHVKAGVLFIVPRFFVVSKIADSDGLSWFSIVTTPDPIFTHLAGRTSVWKALSPEVLQAAFKVDPEVEKAFRSKRTSDAIFFSPSN
| Function: |
|
| |
| Number of residues |
356 |
| Chemical mass |
38464.5698 |
Monoisotopic mass |
38440.9284 |
| Bibliographic data: |
| Authors |
| Lin X. et al. |
| Title |
| Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana. Nature 402:761-768. |
| Year |
Source |
| 1999 |
Journal |
| Additional information: |
| Legumins occur in seeds of many leguminous & nonleguminous plants and are the the source of sulfur-containing amino acids in seed meals. |
| Database reference: |
| SWISS-PROT accession number: Q9SIA7 |