BIOPEP-UWM: Report
| ID |
1199 |
| Name |
bilin binding protein BBP, white butterfly (Pieris brassicae) |
MQYLIVLALVAAASANVYHDGACPEVKPVDNFDWSNYHGKWWEVAKYPNSVEKYGKCGWAEYTPEGKSVKVSNYHVIHGKEYFIEGTAYPVGDSKIGKIYHKLTYGGVTKENVFNVLSTDNKNYIIGYYCKYDEDKKGHQDFVWVLSRSKVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSEAACKVNN
| Function: |
|
| |
| Number of residues |
189 |
| Chemical mass |
21305.6914 |
Monoisotopic mass |
21292.4995 |
| Bibliographic data: |
| Authors |
| Schmidt F.S., Skerra A. |
| Title |
| The bilin-binding protein of Pieris brassicae. cDNA sequence and regulation of expression reveal distinct features of this insect pigment protein. Eur. J. Biochem. 219:855-863. |
| Year |
Source |
| 1994 |
Journal |
| Additional information: |
| Belongs to lipoclain family. |
| Database reference: |
| SWISS-PROT entry name: BBP_PIEBR, SWISS-PROT accession number: P09464 |