BIOPEP-UWM: Report
| ID |
1544 |
| Name |
Alpha-amylase/subtilisin inhibitor (RASI), rice (Oryza sativa) |
APPPVYDTEGHELSADGSYYVLPASPGHGGGLTMAPRRVIPCPLLVAQETDERRKGFPVRFTPWGGAASPRTLRVSTDVRIRFNAATLCVQSTEWHVGDEPLTGARRVVTGPLIGPSPSGRENAFRVEKYGGGYKLVSCRDSCQDLGVSRDGAGAAWIGASQPPHVVVFKKARPSP
| Function: |
| Inhibitor of the subtilisin and T.castaneum alpha-amylase but not barley alpha-amylase. |
| |
| Number of residues |
176 |
| Chemical mass |
18760.9732 |
Monoisotopic mass |
18749.5238 |
| Bibliographic data: |
| Authors |
| Ohtsubo K.-I., Richardson M. |
| Title |
| The amino acid sequence of a 20 kDa bifunctional subtilisin/alpha-amylase inhibitor from bran of rice (Oryza sativa L.) seeds.FEBS Lett. 309:68-72(1992). |
| Year |
Source |
| 1992 |
Journal |
| Additional information: |
| Member the leguminous Kunitz-type inhibitor family. |
| Database reference: |
SWISS PROT/TREMBL entry name/primary accession number:IAAS_ORYSA/P29421.
Http://www.expasy.org |