BIOPEP-UWM: Report
| ID |
1648 |
| Name |
Thaumatin-like protein TLP7, barley (Hordeum vulgare) |
MASSHVVSLLAGLLLAALAASTDAATITVVNRCSYTVWPGALPGGGVRLDPGQSWALNMPAGTAGARVWPRTGCTFDGSGRGRCITGDCGGALACRVSGQQPTTLAEYTLGQGANKDFFDLSVIDGFNVPMSFEPVGASCRAARCATDITKECLKELQVPGGCASACGKFGGDTYCCRGQFEHNCPPTNYSKFFKGKCPDAYSYAKDDQTSTFTCPAGTNYQIVLCP
| Function: |
|
| |
| Number of residues |
227 |
| Chemical mass |
23643.5351 |
Monoisotopic mass |
23628.1476 |
| Bibliographic data: |
| Authors |
| Reiss E., Horstmann C. |
| Title |
| Drechslera teres - Infected Barley (Hordeum vulgare L.) Leaves Accumulate Eight Isoforms of Thaumatin-like Proteins. Physiol. Mol. Plant Pathol. 58:183-188(2001). |
| Year |
Source |
| 2001 |
Journal |
| Database reference: |
TREMBL primary accession number: Q946Y9.
Http://www.expasy.org |