BIOPEP-UWM: Report
| ID |
1649 |
| Name |
Thaumatin-like protein TLP6, barley (Hordeum vulgare) |
MASSRVVYLLAGLLLAALAATTDAATITVVNRCSYTVWPGALPGGGVRLDPGQSWALNMPAGTAGARVWPRTGCTFDGSGRGRCITGDCNGVLACRVSGQQPTTLAEYTLGQGANKDFFDLSVIDGFNVPMSFEPVGGCRAARCATDITKDCLKELQVPGGCASACGKFGGDTYCCRGQFEHNCPPTNYSMFFKGKCPDAYSYAKDDQTSTFTCPAGTNYQIVLCP
| Function: |
|
| |
| Number of residues |
226 |
| Chemical mass |
23725.7027 |
Monoisotopic mass |
23710.1716 |
| Bibliographic data: |
| Authors |
| Reiss E., Horstmann C. |
| Title |
| Drechslera teres - Infected Barley (Hordeum vulgare L.) Leaves Accumulate Eight Isoforms of Thaumatin-like Proteins. Physiol. Mol. Plant Pathol. 58:183-188(2001). |
| Year |
Source |
| 2001 |
Journal |
| Database reference: |
TREMBL primary accession number: Q946Z0.
Http://www.expasy.org |