BIOPEP-UWM: Report

ID 1833
Name beta-lactoglobulin, gen. var. B, fragment (17-177), bovine (Bos taurus)
sequence
LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Function:
Primary component of whey, it binds retinol and is probably involved in the transport of that molecule. Ref.: Swiss-Prot database (www.expasy.org).
 
Number of residues 161
Chemical mass 18151.8509 Monoisotopic mass 18140.3451



Bibliographic data:
Authors
H.M. Farrell, Jr., R. Jiménez-Flores, G.T. Bleck, E.M. Brown, J.E. Butler, L.K. Creamer, C.L. Hicks, C.M. Hollar, K.F. Ng-Kwai-Hang, H.E. Swaisgood
Title
Nomenclature of the Proteins of Cows’ Milk—Sixth Revision
Year Source
2004 Journal



Additional information:
Signal peptide (1-16): MKCLLLALALTCGAQA

Protein known as: beta-LG, allergen Bos d 5. Chain: from 17 to 177; signal peptide: from 1 to 16.
Beta-lactoglobulin is one of whey proteins involved in retinol binding as well as transport of that compound. Beta-lactoglobulin belongs to lipocalin family.
Ref.: Swiss-Prot database (www.expasy.org).



Database reference:
Swiss-Prot database protein entry name/accesion number: LACB_BOVIN/P02754. NCBI Taxonomic Identifier: 9913.

BIOPEP-UWM database of allergenic proteins: ID 14