BIOPEP-UWM: Report

ID 1837
Name alpha S1-casein var. D, bovine (Bos taurus) including modifications
sequence
RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIG{S[3*]}E{S[3*]}TEDQ{T[3*]}MEDIKQMEAE{S[3*]}I{S[3*]}{S[3*]}{S[3*]}EEIVPN{S[3*]}VEQKHIQKEDVPSERYLGYLEQLLRLKKYKVPQLEIVPN{S[3*]}AEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPLW
Function:
 
Number of residues 199
Chemical mass 23724.3726 Monoisotopic mass 23710.1511


Bibliographic data:
Authors
Mercier J.-C., Grosclaude F., Ribadeau-Dumas B.
Title
Primary structure of bovine alpha-s1 casein. Complete sequence. Eur. J. Biochem. 23, 41-51, 1971
Year Source
1971 Journal


Additional information:
Casein is one of the major milk proteins and plays important role in the capacity of milk to transport calcium phosphate.

Sequence of mature protein (without signal peptide) is provided. Phosphorylated serine and threonine residues are annotated according to the UniProt database Access. No P02662)

{S[3*]} - phosphoserine: BIOPEP-UWM repository of amino acids and modifications; ID 108
{T[3*]} - phosphothreonine: BIOPEP-UWM repository of amino acids and modifications; ID 109

Sequence without modifications is annotated in the BIOPEP-UWM database of proteins (ID 1089)


Database reference:
UniProt entry name: CAS1_BOVIN, accession number: P02662