BIOPEP-UWM: Report

ID 1838
Name alpha-S2-casein var. A, bovine (Bos taurus) with modified amino acid residues
sequence
KNTMEHV{S[3*]}{S[3*]}{S[3*]}EE{S[3*]}IISQETYKQEKNMAINP{S[3*]}KENL{C}STF{C}KEVVRNANEEEYSIG{S[3*]}{S[3*]}{S[3*]}EE{S[3*]}AEVATEEVKITVDDKHYQKALNEINQFYQKFPQYLQYLYQGPIVLNPWDQVKRNAVPITPTLNREQLSTSEENSKKTVDME{S[3*]}TEVFTKKTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL

Function:
 
Number of residues 207
Chemical mass 25147.9891 Monoisotopic mass 25132.9761



Bibliographic data:
Authors
Brignon G., Ribadeau-Dumas B., Mercier J.-C., Pelissier J.-P., Das B. C.
Title
Complete amino acid sequence of bovine alphaS2-casein. FEBS Letters, 76, 274-279, 1977
Year Source
1977 Journal



Additional information:
Protein known as: allergen Bos d 8. Chain: from 16 to 222; signal peptide: from 1 to 15. Casein is one of the major milk proteins and plays important role in the capacity of milk to transport calcium phosphate.
Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02663/entry).

Sequence of mature protein (without signal peptide) is provided. Modified amino acid residues are annotated according to the UniProt database (Access. No P02663)

{S[3*]} - phosphoserine: BIOPEP-UWM repository of amino acids and modifications; ID 108
{C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111

Sequence without modifications is annotated in the BIOPEP-UWM database of proteins (ID 1090)




Database reference:
UniProt database protein entry name/accesion number: CASA2_BOVIN/P02663. NCBI Taxonomic identifier: 9913.