BIOPEP-UWM: Report

ID 1849
Name kappa-casein var. B2, bovine (Bos taurus) with modifications
sequence
{P[4O]}EQNQEQPIR{C}EKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVALINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKS{C}QAQPTTMARHPHPHLSFMAIPPKKNQDKTEIPTINTIA{S[3*]}GEPTSTPTIEAVESTVATLEASPEVTESPPEINTVQVTSTAV

Function:
 
Number of residues 169
Chemical mass 18993.0773 Monoisotopic mass 18981.5129



Bibliographic data:
Authors
Mercier J.‐C., Brignon G., Ribadeau‐Dumas B.
Title
Structure primaire de la caseine kappaB bovine: Sequence complete. European Journal of Biochemistry, 35, 222-235, 1973
Year Source
1973 Journal



Additional information:
Protein known as: allergen Bos d 8. Chain: from 22 to 190; signal peptide: from 1 to 21.
Casein is one of the major milk proteins produced in mammary gland. Casein plays important role in determination of surface properties of casein micelles.
Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02668/entry).

Sequence of mature protein (without signal peptide) is provided. Modified amino acid residues are annotated according to the UniProt database (Access. No P02668)

{S[3*]} - phosphoserine: BIOPEP-UWM repository of amino acids and modifications; ID 108
{P[4O]} - L-pyroglutamic acid, BIOPEP-UWM repository of amino acids and modifications, ID 110
{C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111

Sequence without modifications is annotated in the BIOPEP-UWM database of proteins (ID 1811)



Database reference:
UniProt database protein entry name/accesion number: CASK_BOVIN/P02668. NCBI Taxonomic Identifier: 9913.