BIOPEP-UWM: Report

ID 1852
Name beta-lactoglobulin, gen. var. B, bovine (Bos taurus) with disulfide bonds
sequence
LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGE{C}AQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLF{C}MENSAPEQSLA{C}QCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQ{C}HI

Function:
Primary component of whey, it binds retinol and is probably involved in the transport of that molecule. Ref.: UniProt (https://www.uniprot.org/uniprotkb/P02754/entry).
 
Number of residues 161
Chemical mass 18151.8509 Monoisotopic mass 18140.3451



Bibliographic data:
Authors
Alexander L. J., Hayes G., Pearse M. J., Beattie C. W., Stewart A. F., Willis I. M., Mackinlay A. G.
Title
Complete sequence of the bovine beta-lactoglobulin cDNA. Nucleic Acids Res., 17, 6739, 1989
Year Source
1989 Journal



Additional information:
Signal peptide not included

Protein known as: beta-LG, allergen Bos d 5. Chain: from 17 to 177; signal peptide: from 1 to 16.
Beta-lactoglobulin is one of whey proteins involved in retinol binding as well as transport of that compound. Beta-lactoglobulin belongs to lipocalin family.
Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02754/entry).

{C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111





Database reference:
UniProt/Swiss-Prot database protein entry name/accesion number: LACB_BOVIN/P02754. NCBI Taxonomic Identifier: 9913.

BIOPEP-UWM database of allergenic proteins: ID 14