BIOPEP-UWM: Report

ID 1857
Name Bovine serum albumin with disulfide bonds
sequence
DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKT{C}VADESHAG{C}EKSLHTLFGDEL{C}KVASLRETYGDMAD{C}{C}EKQEPERNE{C}FLSHKDDSPDLPKLKPDPNTL{C}DEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQE{C}{C}QAEDKGA{C}LLPKIETMREKVLASSARQRLR{C}ASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKE{C}{C}HGDLLE{C}ADDRADLAKYI{C}DNQDTISSKLKE{C}{C}DKPLLEKSH{C}IAEVEKDAIPENLPPLTADFAEDKDV{C}KNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEE{C}{C}AKDDPHACYSTVFDKLKHLVDEPQNLIKQN{C}DQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTR{C}{C}TKPESERMP{C}TEDYLSLILNRL{C}VLHEKTPVSEKVTK{C}{C}TESLVNRRP{C}FSALTPDETYVPKAFDEKLFTFHADI{C}TLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDK{C}{C}AADDKEA{C}FAVEGPKLVVSTQTALA
Function:
Main protein of plasma, with properties of binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02769/entry).
 
Number of residues 583
Chemical mass 66432.1247 Monoisotopic mass 66389.7553


Bibliographic data:
Authors
Patterson J. E., Geller D. M.
Title
Bovine microsomal albumin: amino terminal sequence of bovine proalbumin. Biochem. Biophys. Res. Commun. 74, 1220-1226, 1977
Year Source
1977 Journal


Additional information:
Only mature chain included (residues 25-607 in precursor sequence).
Glycosylation and putative phosphorylation sites not included.

Protein known as: allergen Bos d 6, BSA. Allergenic protein for humans.
Ref.: UniProt database (https://www.uniprot.org/uniprotkb/P02769/entry).

{C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111


Database reference:
UniProt/Swiss-Prot database protein entry name/accesion number: ALBU_BOVIN/P02769. NCBI Taxonomic Identifier: 9913.