BIOPEP-UWM: Report

ID 1867
Name Vicilin-like antimicrobial peptides 2-2 Gossypium arboreum
sequence
YRGEKQWRKERERREEEMEPEEEEQEESESRKSWFLMPKSRPVMTTDAGEMRMVRSPGGRIVDKPLHMGFITMEPQSLFIPQYLDSSLILFVRTGEARVG{C}IYKDEMVERRLKIGDVYHIPAGSTFYILNPGEGQRLHII{C}SIDPSESLNLDTFQSFFIGGGTHPTSVLAGFGPETLSTAFNVSMSKLEEIMRGQQEGPIVHVTKSHAPSIWTKLSQLQEQDRLKQVKRMVQGEADEEEKEWSWWKLFGIFSGNERRIFGDKAPDSYNIYKRKADFKNDYGWSVAVDGSVYKPFKHSGTGVYLVNLTAGSMMAPHVNPRATEYGIVLRGTGRIQIVYPNGTLAMDARVREGDVFWVPRYFAF{C}QIASRSSPFEFFGFTTTSDKNRPQFLVGANSLLHTFNTPELAAAFGVTEERMRRFINAQKEAVILPSASAAPPDEDLKGREEKSEDEGPKVIRNFGDQMIMGFD

Function:
 
Number of residues 467
Chemical mass 53109.4407 Monoisotopic mass 53076.3791



Bibliographic data:
Authors
Mudge J., Ramaraj T., Lindquist I.E., Bharti A.K., Sundararajan A., Cameron C.T., Woodward J.E., May G.D., Brubaker C., Broadhvest J., Wilkins T.A.
Title
Submitted to EMBL/GenBank/DDBJ databases, 2014
Year Source
2014 www sites



Additional information:
Signal peptide (residues 1-23) is excluded from the sequence.

Position of signal peptide has not been detected experimentally and is not available in the UniProt database (Access: 2024.01.19)

Signal peptide has been predicted using SignalP-4.1 program (https://services.healthtech.dtu.dk/services/SignalP-4.1/) (Access: 2024.01.19) using eukaryote protein fetures. All other features were default.

Reference describing program:
Petersen T. N., Brunak S., von Heijne G., Nielsen H., 2011, SignalP 4.0: discriminating signal peptides from transmembrane regions. Nature Methods, 8, 785-786

{C} - cysteine involved in formation of disulfide bond, BIOPEP-UWM repository of amino acids and modifications, ID 111

All cysteine residues are assumed as involved in disulfide bond. One of these residues may contain free sulfhydryl group or be involved in interchain disulkfide bond. True disulfide bond pattern is unknown according to the UniProt database (Accessed 2024.01.19)





Database reference:
UniProt/SWISS-PROT: Entry name: A0A0B0PUP3_GOSAR, Accession No: A0A0B0PUP3, https://www.uniprot.org/uniprotkb/A0A0B0PUP3/entry