BIOPEP-UWM: Sensory peptides and amino acids

Number of sensory peptides/amino acids in a database: 605 
  ID Name Sequence Chem. mass Monois. mass
Sensory peptide/amino acid data  421  Salty taste enhancing peptide  AR  245.2781  245.1484 
Sensory peptide/amino acid data  422  Salty taste enhancing peptide  RG  231.2516  231.1328 
Sensory peptide/amino acid data  423  Salty taste enhancing peptide  RS  261.2775  261.1433 
Sensory peptide/amino acid data  424  Salty taste enhancing peptide  RV  273.3311  273.1796 
Sensory peptide/amino acid data  425  Salty taste enhancing peptide  VR  273.3311  273.1796 
Sensory peptide/amino acid data  426  Salty taste enhancing peptide  RM  305.3972  305.1517 
Sensory peptide/amino acid data  427  Bitter peptide  RPKHPIKHQ  1140.3379  1139.6658 
Sensory peptide/amino acid data  428  Umami peptide  SSRNEQSR  962.9619  962.4516 
Sensory peptide/amino acid data  429  Umami enhancing peptide  EGSEAPDGSSR  1091.0413  1090.4511 
Sensory peptide/amino acid data  430  Salty peptide  DEKR  546.5731  546.2753 
Sensory peptide/amino acid data  431  Bitter peptide  APFPEVFG  862.9653  862.4211 
Sensory peptide/amino acid data  432  Bitter peptide  YQQPVLGPVRGPFPI  1667.9424  1666.9167 
Sensory peptide/amino acid data  433  Bitter peptide  YQQPVLGPVRGPFPIIV  1880.2303  1879.0687 
Sensory peptide/amino acid data  434  Bitter peptide  QNDKIHPFAQTQSLVYPFGPIP  2497.7937  2496.2761 
Sensory peptide/amino acid data  435  Bitter peptide  QNDKIHPFAQTQSLVYPFGPIPNSLPQNIPPLTQTPVVV  4296.8639  4294.2718 
First Previous Page: Next Last
Page 29 / 41 
Search: by: exact
ID (e.g. 1)
Name (e.g. bitter peptide)
Activity (e.g. umami) List of activities
Reference (e. g. Ishibashi)
Mass (e.g. 10000-20000)
Sequence (e.g. RR)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)