Untitled Document

BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5362
	ID	Name	Sequence	Chem. mass	Monois. mass
Peptide Data	3131	Inhibitor of cholesteryl ester transfer protein	WRMWY	840.9891	840.3730	0.00 EC₅₀
Peptide Data	3132	Inhibitor of cholesteryl ester transfer protein	WRMWYVP	1037.2347	1036.4938	0.00 EC₅₀
Peptide Data	3133	Inhibitor of cholesteryl ester transfer protein	RMWYVPA	922.1029	921.4517	0.00 EC₅₀
Peptide Data	3134	Inhibitor of cholesteryl ester transfer protein	TWRMWYVPA	1209.4160	1208.5783	0.00 EC₅₀
Peptide Data	3135	Inhibitor of cholesteryl ester transfer protein	WRMWYVPA	1108.3124	1107.5308	0.00 EC₅₀
Peptide Data	3136	Inhibitor of cholesteryl ester transfer protein	VTWRMWYVPA	1308.5467	1307.6465	0.00 EC₅₀
Peptide Data	3137	Esculentin-1b fragment: 1-18	GIFSKLAGKKLKNLLISG	1887.3070	1886.1681	0.00 EC₅₀
Peptide Data	3138	Antibacterial peptide	HLRRCGKKPYILMACS	1876.3180	1874.9764	0.00 EC₅₀
Peptide Data	3139	erythropoietin receptor agonist peptide	EAQGCRWGWVGNCKEWLGDEYAKNTGTPAEKGKSRNPP	4221.5971	4218.9690	0.00 EC₅₀
Peptide Data	3140	erythropoietin receptor agonist peptide	DVEVCRGGWVGHCNAWLRDEYNRQPKKPVQQQVVYSTR	4502.9964	4500.2013	0.00 EC₅₀
Peptide Data	3141	erythropoietin receptor agonist peptide	SLEPCRGGWVGHCNEWQRDEYAINPKWPNAPIEDPNPL	4389.7881	4387.0263	0.00 EC₅₀
Peptide Data	3142	erythropoietin receptor agonist peptide	QVDTCTRGWVGHCNAWMGDEYAKTPGLPPMPQSDYLKPR	4406.9481	4404.0271	0.00 EC₅₀
Peptide Data	3143	erythropoietin receptor agonist peptide	GLGACRRGWVGHCNDWLNDEYAKKPGYAMPDGYPHNGT	4207.5967	4204.8784	0.00 EC₅₀
Peptide Data	3144	erythropoietin receptor agonist peptide	EGEVCLPGWVGHCKYWLMDEYANIPRNPTPRSNELKPP	4397.9582	4395.0960	0.00 EC₅₀
Peptide Data	3145	erythropoietin receptor agonist peptide	DFDVCRRGWVGHCKDWLSDEYASNPSYPVPHSYYLNPP	4471.8439	4468.9994	0.00 EC₅₀