BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5601 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  3146 erythropoietin receptor agonist peptide GKEVCRRGWVGHCQEWPMDEYTRNPSHPVPHNSRHKTP 4509.9755 4507.1071 0.00 EC50
Peptide Data  3148 erythropoietin receptor agonist peptide DVHECRPGWVGHCKDWLSDEYASNRRSPEPHRNYPIPP 4501.8813 4499.0761 0.00 EC50
Peptide Data  3149 erythropoietin receptor agonist peptide NIQGCIRGWVGQCKDWLRDEYAREHTNQETPNNLLNPP 4466.8752 4464.1174 0.00 EC50
Peptide Data  3150 erythropoietin receptor agonist peptide DREGCRRGWVGQCKAWFN 2168.4169 2166.9923 0.04 EC50
Peptide Data  3151 erythropoietin receptor agonist peptide REGCRRGWVGQCKAWFN 2053.3297 2051.9655 0.09 EC50
Peptide Data  3152 erythropoietin receptor agonist peptide EGCRRGWVGQCKAWFN 1897.1445 1895.8646 3.70 EC50
Peptide Data  3153 erythropoietin receptor agonist peptide DVEACGGGWVGHCNYWLRDEYASKPIKQVPPGNHNQPS 4210.5729 4207.9320 0.00 EC50
Peptide Data  3154 erythropoietin receptor agonist peptide DREGCRRGWVGQCKAWFNDEYAKPPKKPFRNSYSLGPA 4415.9177 4413.1371 0.00 EC50
Peptide Data  3155 erythropoietin receptor agonist peptide LLQMCSPGWVGHCNDWPRDEYANNPPNPVVDRQALTPP 4288.7501 4285.9821 0.00 EC50
Peptide Data  3156 erythropoietin receptor agonist peptide DFEDCQGGWVGHCNDWLGDEYARHPRYGATQTLSVNRH 4391.6389 4388.9193 0.00 EC50
Peptide Data  3157 erythropoietin receptor agonist peptide DLEVCRGGWVGHCKDWIWDEYARNPRYPDPQRKEVKSP 4587.0680 4584.1900 0.00 EC50
Peptide Data  3159 erythropoietin receptor agonist peptide AKVVCRNGWVGHCSAWLTDEYESNPNTRIPNTFDMKTP 4338.8070 4336.0187 0.00 EC50
Peptide Data  3160 erythropoietin receptor agonist peptide DLAGCRRGWVGHCSEWLRDEYTSNPRYPVAPSYRLQPP 4433.8900 4431.1113 0.00 EC50
Peptide Data  3161 erythropoietin receptor agonist peptide YSDVCRRGWVGHCEDWLGDEYSSQPSYALPHSTSLNPR 4369.6696 4366.9486 0.00 EC50
Peptide Data  3163 entherostatin APGPR 496.5591 496.2750 0.00 EC50
First Previous Page: Next Last
Page 36 / 374
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)