BIOPEP-UWM: Bioactive peptides

Number of peptides in database: 5601 
  ID Name Sequence Chem. mass Monois. mass
Peptide Data  3131 Inhibitor of cholesteryl ester transfer protein WRMWY 840.9891 840.3730 0.00 EC50
Peptide Data  3132 Inhibitor of cholesteryl ester transfer protein WRMWYVP 1037.2347 1036.4938 0.00 EC50
Peptide Data  3133 Inhibitor of cholesteryl ester transfer protein RMWYVPA 922.1029 921.4517 0.00 EC50
Peptide Data  3134 Inhibitor of cholesteryl ester transfer protein TWRMWYVPA 1209.4160 1208.5783 0.00 EC50
Peptide Data  3135 Inhibitor of cholesteryl ester transfer protein WRMWYVPA 1108.3124 1107.5308 0.00 EC50
Peptide Data  3136 Inhibitor of cholesteryl ester transfer protein VTWRMWYVPA 1308.5467 1307.6465 0.00 EC50
Peptide Data  3137 Esculentin-1b fragment: 1-18 GIFSKLAGKKLKNLLISG 1887.3070 1886.1681 0.00 EC50
Peptide Data  3138 Antibacterial peptide HLRRCGKKPYILMACS 1876.3180 1874.9764 0.00 EC50
Peptide Data  3139 erythropoietin receptor agonist peptide EAQGCRWGWVGNCKEWLGDEYAKNTGTPAEKGKSRNPP 4221.5971 4218.9690 0.00 EC50
Peptide Data  3140 erythropoietin receptor agonist peptide DVEVCRGGWVGHCNAWLRDEYNRQPKKPVQQQVVYSTR 4502.9964 4500.2013 0.00 EC50
Peptide Data  3141 erythropoietin receptor agonist peptide SLEPCRGGWVGHCNEWQRDEYAINPKWPNAPIEDPNPL 4389.7881 4387.0263 0.00 EC50
Peptide Data  3142 erythropoietin receptor agonist peptide QVDTCTRGWVGHCNAWMGDEYAKTPGLPPMPQSDYLKPR 4406.9481 4404.0271 0.00 EC50
Peptide Data  3143 erythropoietin receptor agonist peptide GLGACRRGWVGHCNDWLNDEYAKKPGYAMPDGYPHNGT 4207.5967 4204.8784 0.00 EC50
Peptide Data  3144 erythropoietin receptor agonist peptide EGEVCLPGWVGHCKYWLMDEYANIPRNPTPRSNELKPP 4397.9582 4395.0960 0.00 EC50
Peptide Data  3145 erythropoietin receptor agonist peptide DFDVCRRGWVGHCKDWLSDEYASNPSYPVPHSYYLNPP 4471.8439 4468.9994 0.00 EC50
First Previous Page: Next Last
Page 35 / 374
Search: by: exact
ID (e.g. 2572)
Name (e.g. lactorphin)
Activity (e. g. antioxidative) List of activities
Mass (e.g. 700-1200)
Reference (e.g. Meisel)
Sequence (e.g. IPP)
Number of residues (e.g. 2)
InChIKey (e.g. JNTMAZFVYNDPLB-PEDHHIEDSA-N)