BIOPEP-UWM: Peptide Data
ID
Name
Sequence
DCYCRIPACIAGERRYGTCIYQGRLWAFCC
InChIKey
Chemical Mass
Number of amino acid residues
Monoisotopic Mass
EC50
IC50
µM
Activity
alpha-amylase inhibitor | aami
accelerating | acc
ACE 2 activator | aac2
ACE inhibitor | ah
ACE2 inhibitor | ace2
AChE inhibitor | ache
activating ubiquitin-mediated proteolysis | apr
acylaminoacyl peptidase inhibitor | acylp
alanine carboxypeptidase inhibitor | acar
alcohol dehydrogenase activator | adha
alkaline phosphatase inhibitor | alph
alpha-glucosidase inhibitor | glui
anorectic | an
anti inflammatory | ai
anti-apoptotic | aapt
antiamnestic | am
antiartherosclerotic | aart
antibacterial | ab
anticancer | ac
antidiabetic | adb
antifungal | af
antioxidative | ao
antithrombotic | at
antiviral | avi
bacterial permease ligand | lig
BChE inhibitor | bche
binding | bin
bitter taste peptide | bi
bitterness suppressing | bis
calpain 1 inhibitor | cal1
Calpain 2 inhibitor | cal2
CaMKII Inhibitor | cmk2
CaMPDE inhibitor | 35pd
cathepsin B inhibitor | catb
celiac toxic | ctox
chemotactic | che
citrate lyase deacetylase inhibitor | cld
contracting | con
cyclooxygenase-1 inhibitor | cox1
cyclooxygenase-2 inhibitor | cox2
D-Ala-D-Ala dipeptidase inhibitor | dada
dipeptidyl peptidase III inhibitor | dpp3
dipeptidyl peptidase IV inhibitor | dpp
embryotoxic | emb
erk1 inhibitor | erk1
farnesyltransferase inhibitor | far
furin inhibitor | fur
glutamate carboxypeptidase II inhibitor | gluc2
glutamate carboxypeptidase inhibitor | gluc
haemolytic | he
heparin binding | hep_bin
HMG-CoA reductase inhibitor | HMGi
Hyaluronidase inhibitor | hyal
hypocholesterolemic | hypc
hypolipidemic | hypl
hypotensive | hyp
hypouricemic | hur
immunomodulating | im
immunostimulating | is
inhibitor | inh
inhibitor of cytosol alanyl aminopeptidase | caa
Inhibitor of endothelin-1 release | ien1
inhibitor of tripeptidyl peptidase II | tpp2
lactocepin inhibitor | lcp
Leucyltransferase inhibitor | leut
lipoxygenase inhibitor | lox
matrix metalloproteinase-1 inhibitor | mmp1
melanin synthesis inhibitor | msi
membrane -active peptide | mac
microbial collagenase inhibitor | mci
mycolysin inhibitor | myc
natriuretic | nat
neprilysin 2 inhibitor | nep2
neprilysin inhibitor | nep
neurolysin inhibitor | neul
neuropeptide | ne
neuroprotective | neup
opioid | op
opioid agonist | op1
opioid antagonist | op2
orphan receptor GPR14 agonist | orp
osteoanabolic | ost
PAM inhibitor | pam
pancreatic elastase inhibitor | pel
pancreatic lipase inhibitor | plip
peptidylprolyl isomerase inhibitor | ppi
phospholipase A2 inhibitor | pla2
PPARα agonist | ppaa
PPARγ antagonist | ppar
Protein Kinase C inhibitor | PKC
pseudolysin inhibitor | pseud
reacting | rea
regulating | re
renin inhibitor | ren
stimulating | sti
stimulating insulin secretion | sins
thermolysin inhibitor | therm
thymidylate synthase inhibitor | ts
toxic | tox
tubulin-tyrosine ligase inhibitor | ttl
tyrosinase inhibitor | tyr
umami | um
vasoconstrictor | vsc
xaa-pro inhibitor | xaap
xanthine oxidase inhibitor | xox
XIAP inhibitor | xiap
references
function information
additional information
database references
screen and print peptide data
list of peptides