BIOPEP-UWM: Protein Data
ID
Name
Sequence
RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIG{S[3*]}E{S[3*]}TEDQ{T[3*]}MEDIKQMEAE{S[3*]}I{S[3*]}{S[3*]}{S[3*]}EEIVPN{S[3*]}VEQKHIQKEDVPSERYLGYLEQLLRLKKYKVPQLEIVPN{S[3*]}AEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPLW
Chemical Mass
Number of residues
Monoisotopic Mass
Additional Information
Casein is one of the major milk proteins and plays important role in the capacity of milk to transport calcium phosphate. Sequence of mature protein (without signal peptide) is provided. Phosphorylated serine and threonine residues are annotated according to the UniProt database Access. No P02662) {S[3*]} - phosphoserine: BIOPEP-UWM repository of amino acids and modifications; ID 108 {T[3*]} - phosphothreonine: BIOPEP-UWM repository of amino acids and modifications; ID 109 Sequence without modifications is annotated in the BIOPEP-UWM database of proteins (ID 1089)
reference
function information
database references
screen and print protein data
list of proteins